Recombinant Human TGIF2LX protein (ab164816)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEAAADGPAETQSPVEKDSPAKTQSPAQDTSIMSRNNADTGRVLALPEHK KKRKGNLPAESVKILRDWMYKHRFKAYPSEEEKQMLSEKTNLSLLQISNW FINARRRILPDMLQQRRNDPIIGHKTGKDAHATHLQSTEASVPAKSGPSG PDNVQSLPLWPLPKGQMSREKQPDPESAPSQKLTGIAQPKKKVKVSVTSP SSPELVSPEEHADFSSFLLLVDAAVQRAAELELEKKQEPNP
    • Amino acids
      1 to 241
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164816 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Homeobox protein TGIF2LX
    • MGC130458
    • testis expressed homeobox Tex1
    • Tex1
    • TF2LX_HUMAN
    • TGF
    • TGF beta induced transcription factor like protein
    • TGF(beta) induced transcription factor 2 like
    • TGF-beta-induced transcription factor 2-like protein
    • TGFB induced factor 2 like protein X linked
    • TGFB induced factor homeobox 2 like, X linked
    • TGFB-induced factor 2-like protein
    • TGIF homeobox 1
    • TGIF-like on the X
    • TGIF2LX
    • TGIFLX
    • Tgifx1
    • X-linked
    see all
  • Function
    May have a transcription role in testis.
  • Tissue specificity
    Specifically expressed in adult testis.
  • Sequence similarities
    Belongs to the TALE/TGIF homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab164816 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164816 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164816.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up