Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ATESVKQEEAGVRPSAGNVSTHPSLSQRPGGSTKSHPEPQTPKDSPSKSS AEAQTPEDTPNKSGAEAKTQKDSSNKSGAEAKTQKGSTSKSGSEAQTTKD STSKSHPELQTPKDSTGKSGAEAQTPEDSPNRSGAEAKTQKDSPSKSGSE AQTTKDVPNKSGADGQTPKDGSSKSGAEDQTPKDVPNKSGAEKQTPKDGS NKSGAEEQGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSD NKELPKADTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDV EPKEAEDDDTGPEEGSPPKEEKEKMSGSASSENREGTLSDSTGSEKDDLY PNGSGNGSAEVDHHHHHH
    • Molecular weight
      38 kDa including tags
    • Amino acids
      22 to 381
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab192297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 99% Phosphate Buffer, 0.87% Sodium chloride

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names
    • TGN 46
    • TGN 51
    • TGN38
    • TGN38 homolog
    • TGN46
    • TGN48
    • TGN51
    • TGOLN2
    • TGON2_HUMAN
    • Trans Golgi network integral membrane protein 2
    • Trans golgi network protein 2
    • Trans Golgi network protein TGN51
    • Trans-Golgi network integral membrane protein 2
    • Trans-Golgi network protein TGN51
    • TTGN2
    see all
  • Function
    May be involved in regulating membrane traffic to and from trans-Golgi network.
  • Tissue specificity
    Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells.
  • Cellular localization
    Cell membrane. Golgi apparatus > trans-Golgi network membrane. Primarily in trans-Golgi network. Cycles between the trans-Golgi network and the cell surface returning via endosomes.
  • Information by UniProt

References

ab192297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up