Recombinant Human THAP7 protein (denatured) (ab181931)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMPRHCSAAGCCTRDTRETRNRGISFHR LPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHFEEDCFELVG ISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPAEVSRLRRCRKRC SEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSD LLGPLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQ NEHSYQVGSALLWKRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQ ERAREKRAQADARQTLKEHVQDFAMQLSSSMA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 309
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NP_001008695

Specifications

Our Abpromise guarantee covers the use of ab181931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 85 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names
    • 1810004B07Rik
    • THAP domain containing 7
    • THAP domain-containing protein 7
    • Thap7
    • THAP7_HUMAN
    see all
  • Function
    Chromatin-associated, histone tail-binding protein that represses transcription via recruitment of HDAC3 and nuclear hormone receptor corepressors.
  • Sequence similarities
    Contains 1 THAP-type zinc finger.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab181931.

References

ab181931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up