Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LRCHVCTSSSNCKHSVVCPASSRFCKTTNTVEPLRGNLVKKDCAESCTPS YTLQGQVSSGTSSTQCCQEDLCNEKLHNAAPTRTALAHSALSLGLALSLL AVILAPSL
    • Amino acids
      21 to 128
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160104 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E48
    • E48 antigen
    • Ly 61
    • Ly 6D
    • Ly61
    • Ly6d
    • Lymphocyte antigen 6 complex locus D
    • Lymphocyte antigen 6D
    • Thrombocyte B
    • Thymocyte B cell antigen
    see all
  • Relevance
    Recognizes the mouse ThB cell surface antigen. The ThB antigen is present on most immature T-cells of the thymus, on Ig-, Thy-1- and Ig+ lymphoid cells in bone marrow and peripheral B-cells, but absent on peripheral T-cells. ThB is expressed in high density on spleen cells of AKR, C57BL, DBA/2, SJL and SWR stains. Balb/c, CBA, C3H/He and NZB stans express low densities of the ThB antigen on spleen cells.
  • Cellular localization
    Cell membrane; lipid-anchor; GPI-anchor.

Images

  • ab160104 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160104 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160104.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up