Overview

  • Product name
    Recombinant Human THEM2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMTSMTQSLREVIKAMTKARNFERVLGKITL VSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLCTERGAP GVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIA QGRHTKHLGN
    • Molecular weight
      17 kDa including tags
    • Amino acids
      1 to 140
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab101158 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 15 Kd protein
    • ACO13_HUMAN
    • Acot13
    • Acyl-CoA thioesterase 13
    • Acyl-coenzyme A thioesterase 13
    • HT012
    • hypothalamus protein HT012
    • MGC4961
    • PNAS 27
    • PNAS27
    • Thioesterase superfamily member 2
    see all
  • Function
    Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Has acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Can also hydrolyze 3-hydroxyphenylacetyl-CoA and 3,4-dihydrohyphenylacetyl-CoA (in vitro).
  • Sequence similarities
    Belongs to the thioesterase PaaI family.
  • Cellular localization
    Cytoplasm. Mitochondrion.
  • Information by UniProt

Recombinant Human THEM2 protein images

  • 15% SDS-PAGE showing ab101158 at approximately 17.1kDa (3µg).

References for Recombinant Human THEM2 protein (ab101158)

ab101158 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up