Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLRSCAARLRTLGALCRPPVGRRLPGSEPRPELRSFSSEEVILKDCSVPN PSWNKDLRLLFDQFMKKCEDGSWKRLPSYKRTPTEWIQDFKTHFLDPKLM KEEQMSQAQLFTRSFDDGLGFEYVMFYNDIEKRMVCLFQGGPYLEGPPGF IHGGAIATMIDATVGMCAMMAGGIVMTANLNINYKRPIPLCSVVMINSQL DKVEGRKFFVSCNVQSVDEKTLYSEATSLFIKLNPAKSLT
    • Amino acids
      1 to 240
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165122 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Acyl CoA thioesterase THEM4
    • Acyl coenzyme A thioesterase THEM4
    • C terminal modulator protein
    • Carboxyl-terminal modulator protein
    • CTMP
    • FLJ27206
    • MGC29636
    • OTTHUMP00000015248
    • Them4
    • THEM4_HUMAN
    • Thioesterase superfamily member 4
    see all
  • Function
    According to PubMed:11598301, inhibits AKT1 phosphorylation and activity. According to PubMed:17615157, enhances AKT1 activity by favoring its phosphorylation and translocation to plasma membrane.
  • Tissue specificity
    Expressed predominantly in skeletal muscle, testis, uterus, brain and kidney. Down-regulated in glioblastoma or glioma compared to non-neoplastic brain due to promoter hypermethylation.
  • Post-translational
    modifications
    Phosphorylated.
  • Cellular localization
    Cell membrane. Cell projection > ruffle membrane. Cytoplasm.
  • Information by UniProt

Images

  • ab165122 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165122 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165122.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up