Recombinant Human Thrombin Receptor protein (ab114346)

Overview

  • Product name
    Recombinant Human Thrombin Receptor protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISED ASGYLTSSWLT
    • Molecular weight
      32 kDa including tags
    • Amino acids
      42 to 102

Specifications

Our Abpromise guarantee covers the use of ab114346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CF2R
    • Coagulation factor II (thrombin) receptor
    • Coagulation factor II receptor
    • F2R
    • HTR
    • PAR 1
    • PAR-1
    • PAR1
    • PAR1_HUMAN
    • Protease activated receptor 1
    • Proteinase activated receptor 1
    • Proteinase-activated receptor 1
    • Thrombin receptor
    • TR
    see all
  • Function
    High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development.
  • Tissue specificity
    Platelets and vascular endothelial cells.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand.
    Phosphorylated; probably mediating desensitization prior to the uncoupling and internalization of the receptor.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab114346 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114346 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up