Recombinant Human Thrombin Receptor protein (ab114346)

Overview

  • Product name
    Recombinant Human Thrombin Receptor protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SFLLRNPNDKYEPFWEDEEKNESGLTEYRLVSINKSSPLQKQLPAFISED ASGYLTSSWLT
    • Molecular weight
      32 kDa including tags
    • Amino acids
      42 to 102

Specifications

Our Abpromise guarantee covers the use of ab114346 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CF2R
    • Coagulation factor II (thrombin) receptor
    • Coagulation factor II receptor
    • F2R
    • HTR
    • PAR 1
    • PAR-1
    • PAR1
    • PAR1_HUMAN
    • Protease activated receptor 1
    • Proteinase activated receptor 1
    • Proteinase-activated receptor 1
    • Thrombin receptor
    • TR
    see all
  • Function
    High affinity receptor for activated thrombin coupled to G proteins that stimulate phosphoinositide hydrolysis. May play a role in platelets activation and in vascular development.
  • Tissue specificity
    Platelets and vascular endothelial cells.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Post-translational
    modifications
    A proteolytic cleavage generates a new N-terminus that functions as a tethered ligand.
    Phosphorylated; probably mediating desensitization prior to the uncoupling and internalization of the receptor.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Recombinant Human Thrombin Receptor protein images

  • ab114346 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Thrombin Receptor protein (ab114346)

ab114346 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114346.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up