Recombinant human Thrombomodulin protein (ab98989)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      APAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAA DVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTS YSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCE FHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPL GLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCP AGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAA DQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDGECVEPVDP CFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCD PNTQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGP DSALARHIGTDCDSGKVDGGDSGSGEPPPSPTPGSTLTPPA
    • Molecular weight
      52 kDa
    • Amino acids
      19 to 509

Specifications

Our Abpromise guarantee covers the use of ab98989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Biological Activity : Measured by its ability to activate protein C induced cleavage of the chromogenic substrate, BOC-Asp-Pro Arg-AMC in the presence of thrombin. The specific activity is greater than 500 pmoles/min/ug.
  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    Purity: > 98% by SDS-PAGE gel and HPLC analyses.
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

    Preservative: None
    Constituents: 10mM Sodium phosphate, pH 7.5

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • AHUS 6
    • AHUS6
    • BDCA 3
    • BDCA3
    • CD 141
    • CD141
    • CD141 antigen
    • Fetomodulin
    • Thbd
    • THPH12
    • THRM
    • Thrombomodulin
    • TM
    • TRBM_HUMAN
    see all
  • Function
    Thrombomodulin is a specific endothelial cell receptor that forms a 1:1 stoichiometric complex with thrombin. This complex is responsible for the conversion of protein C to the activated protein C (protein Ca). Once evolved, protein Ca scissions the activated cofactors of the coagulation mechanism, factor Va and factor VIIIa, and thereby reduces the amount of thrombin generated.
  • Tissue specificity
    Endothelial cells are unique in synthesizing thrombomodulin.
  • Involvement in disease
    Defects in THBD are the cause of thrombophilia due to thrombomodulin defect (THR-THBD) [MIM:188040]. A hemostatic disorder characterized by a tendency to thrombosis.
    Defects in THBD are a cause of susceptibility to hemolytic uremic syndrome atypical type 6 (AHUS6) [MIM:612926]. An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Note=Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype.
  • Sequence similarities
    Contains 1 C-type lectin domain.
    Contains 6 EGF-like domains.
  • Post-translational
    modifications
    N-glycosylated.
    The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab98989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for your enquiry and your interest in our products.

We produce some of our products in-house and others are sourced from suppliers whose products we believe will be of interest to our customers. This product falls into the latter ca...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up