Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQ AEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVED ESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW
    • Amino acids
      1 to 146
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Lpgp
    • LPGP1
    • MGC21659
    • OTTHUMP00000233866
    • S14
    • S14 protein
    • SPOT 14
    • Spot 14 protein
    • SPOT14
    • SPOT14 homolog
    • Thrsp
    • THRSP_HUMAN
    • Thyroid hormone inducible hepatic protein
    • Thyroid hormone responsive
    • Thyroid hormone responsive (SPOT14 homolog rat)
    • Thyroid hormone responsive protein
    • Thyroid hormone responsive SPOT14
    • Thyroid hormone-inducible hepatic protein
    see all
  • Function
    Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA (By similarity). May function as transcriptional coactivator. May modulate the transcription factor activity of THRB.
  • Tissue specificity
    Mainly expressed in tissues that synthesize triglycerides.
  • Sequence similarities
    Belongs to the SPOT14 family.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab159697 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159697 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up