Overview

  • Product nameRecombinant Human THTPA protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BU02
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAQGLIEVERKFLPGPGTEERLQELGGTLE YRVTFRDTYYDTPELSLMQADHWLRRREDSGWELKCPGAAGVLGPHTEYK ELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVASFVTKRSAWKL VLLGADEEEPQLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSS MLGVPAQETAPAKLIVYLQRFRPQDYQRLLEVNSSRERPQETEDPDHCLG
    • Molecular weight28 kDa including tags
    • Amino acids1 to 230
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab98233 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • FLJ33428
    • FLJ36892
    • MGC2652
    • thiamine triphosphatase
    • THTP
    • ThTPase
    see all
  • RelevanceThiamine triphosphatase (THTPA) catalyzes the hydrolysis of thiamine triphosphate (THTP) to thiamine diphosphate (THDP), which is the major cellular form of thiamine (vitamin B1).
  • Cellular localizationCytoplasm.

Recombinant Human THTPA protein images

  • 15% SDS-PAGE analysis of 3µg ab98233

References for Recombinant Human THTPA protein (ab98233)

ab98233 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab98233.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"