Recombinant Human Thymidine Phosphorylase protein (ab101169)

Overview

  • Product name
    Recombinant Human Thymidine Phosphorylase protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAPPAPGDFSGEGSQGLPDPSPEPKQLPEL IRMKRDGGRLSEADIRGFVAAVVNGSAQGAQIGAMLMAIRLRGMDLEETS VLTQALAQSGQQLEWPEAWRQQLVDKHSTGGVGDKVSLVLAPALAACGCK VPMISGRGLGHTGGTLDKLESIPGFNVIQSPEQMQVLLDQAGCCIVGQSE QLVPADGILYAARDVTATVDSLPLITASILSKKLVEGLSALVVDVKFGGA AVFPNQEQARELAKTLVGVGASLGLRVAAALTAMDKPLGRCVGHALEVEE ALLCMDGAGPPDLRDLVTTLGGALLWLSGHAGTQAQGAARVAAALDDGSA LGRFERMLAAQGVDPGLARALCSGSPAERRQLLPRAREQEELLAPADGTV ELVRALPLALVLHELGAGRSRAGEPLRLGVGAELLVDVGQRLRRGTPWLR VHRDGPALSGPQSRALQEALVLSDRAPFAAPSPFAELVLPPQQ
    • Molecular weight
      51 kDa including tags
    • Amino acids
      11 to 482
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101169 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101169 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • ECGF
    • ECGF 1
    • ECGF1
    • Endothelial cell growth factor 1
    • Endothelial cell growth factor 1 platelet derived
    • Endothelial cell growth factor, platelet-derived
    • Gliostatin
    • hPD ECGF
    • MEDPS1
    • MNGIE
    • MTDPS1
    • PD ECGF
    • PD-ECGF
    • PDECGF
    • PDEGF
    • Platelet derived endothelial cell growth factor
    • Platelet derived endothelial growth factor
    • Platelet-derived endothelial cell growth factor
    • TdRPase
    • Thymidine phosphorylase
    • TP
    • Tymp
    • TYPH_HUMAN
    see all
  • Function
    May have a role in maintaining the integrity of the blood vessels. Has growth promoting activity on endothelial cells, angiogenic activity in vivo and chemotactic activity on endothelial cells in vitro.
    Catalyzes the reversible phosphorolysis of thymidine. The produced molecules are then utilized as carbon and energy sources or in the rescue of pyrimidine bases for nucleotide synthesis.
  • Pathway
    Pyrimidine metabolism; dTMP biosynthesis via salvage pathway; dTMP from thymine: step 1/2.
  • Involvement in disease
    Mitochondrial DNA depletion syndrome 1 (MTDPS1) [MIM:603041]: A multisystem disease associated with mitochondrial dysfunction. It is clinically characterized by onset between the second and fifth decades of life, ptosis, progressive external ophthalmoplegia, gastrointestinal dysmotility (often pseudoobstruction), diffuse leukoencephalopathy, cachexia, peripheral neuropathy, and myopathy. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities
    Belongs to the thymidine/pyrimidine-nucleoside phosphorylase family.
  • Information by UniProt

Recombinant Human Thymidine Phosphorylase protein images

  • 15% SDS-PAGE showing ab101169 at approximately 51.3kDa (3µg).

References for Recombinant Human Thymidine Phosphorylase protein (ab101169)

ab101169 has not yet been referenced specifically in any publications.

Product Wall



The endotoxins have not been removed, but the lab has tested the protein and the endotoxin level is low, ie. 0.37 EU/ug (determined by LAL method).

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up