Recombinant Human Thymidylate Synthase protein (ab91972)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKD DRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGST NAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGA EYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMA
    • Amino acids
      1 to 191

Specifications

Our Abpromise guarantee covers the use of ab91972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Form
    Lyophilised
  • Additional notes
    Protein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • Reconstitution
    Reconstitute with 97 µl aqua dest.

General Info

  • Alternative names
    • d TMP synthase
    • EC 2.1.1.45
    • HsT422
    • MGC88736
    • OTTHUMP00000162195
    • Thymidylate synthase
    • Thymidylate synthetase
    • TMS
    • TS
    • TSase
    • Tyms
    • TYMS protein
    • Tyms thymidylate synthetase
    • TYSY_HUMAN
    see all
  • Function
    Contributes to the de novo mitochondrial thymidylate biosynthesis pathway.
  • Pathway
    Pyrimidine metabolism; dTTP biosynthesis.
  • Sequence similarities
    Belongs to the thymidylate synthase family.
  • Cellular localization
    Nucleus. Cytoplasm. Mitochondrion. Mitochondrion matrix. Mitochondrion inner membrane.
  • Information by UniProt

Images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References

ab91972 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab91972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up