Recombinant Human Thymidylate Synthase protein (ab91972)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMPVAGSELPRRPLPPAAQERDAEPRPPHGELQYLGQIQHILRCGVRKD DRTGTGTLSVFGMQARYSLRDEFPLLTTKRVFWKGVLEELLWFIKGST NAKELSSKGVKIWDANGSRDFLDSLGFSTREEGDLGPVYGFQWRHFGA EYRDMESDYSGQGVDQLQRVIDTIKTNPDDRRIIMCAWNPRDLPLMA
    • Amino acids1 to 191

Specifications

Our Abpromise guarantee covers the use of ab91972 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • FormLyophilised
  • Additional notesProtein Identity confirmed by Mass Spectrometry (MS/MS) (acquired on initial reference batch).
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5

  • ReconstitutionReconstitute with 97 µl aqua dest.

General Info

  • Alternative names
    • d TMP synthase
    • EC 2.1.1.45
    • HsT422
    • MGC88736
    • OTTHUMP00000162195
    • Thymidylate synthase
    • Thymidylate synthetase
    • TMS
    • TS
    • TSase
    • Tyms
    • TYMS protein
    • Tyms thymidylate synthetase
    • TYSY_HUMAN
    see all
  • FunctionContributes to the de novo mitochondrial thymidylate biosynthesis pathway.
  • PathwayPyrimidine metabolism; dTTP biosynthesis.
  • Sequence similaritiesBelongs to the thymidylate synthase family.
  • Cellular localizationNucleus. Cytoplasm. Mitochondrion. Mitochondrion matrix. Mitochondrion inner membrane.
  • Information by UniProt

Recombinant Human Thymidylate Synthase protein images

  • The image shows an electrophoretic assay performed using an Agilent 5100 ALP. In some images coloured control bands can be seen at 15 kDa (green) and/or 240 kDa (purple). The protein-specific band is blue.

References for Recombinant Human Thymidylate Synthase protein (ab91972)

ab91972 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab91972.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"