Recombinant Human Thymine DNA glycosylase protein (ab114876)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ13569
    • SpeciesHuman
    • SequenceMEAENAGSYSLQQAQAFYTFPFQQLMAEAPNMAVVNEQQMPEEVPAPAPA QEPVQEAPKGRKRKPRTTEPKQPVEPKKPVESKKSGKSAKSKEKQEKITD TFKVKRKVDRFNGVSEAELLTKTLPDILTFNLDIVIIGINPGLMAAYKGH HYPGPGNHFWKCLFMSGLSEVQLNHMDDHTLPGKYGIGFTNMVERTTPGS KDLSSKEFREGGRILVQKLQKYQPRIAVFNGKCIYEIFSKEVFGVKVKNL EFGLQPHKIPDTETLCYGMPSSSARCAQFPRAQDKVHYYIKLKDLRDQLK GIERNMDVQEVQYTFDLQLAQEDAKKMAVKEEKYDPGYEAAYGGAYGENP CSSEPCGFSSNGLIESVELRGESAFSGIPNGQWMTQSFTDQIPSFSNHCG TQEQEEESHA
    • Molecular weight71 kDa including tags
    • Amino acids1 to 410
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114876 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notes

    Best use within three months from the date of receipt of this protein.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C JUN leucine zipper interactive protein
    • C-JUN leucine zipper interactive protein JZA-3
    • E130317C12Rik
    • EC 3.2.2.29
    • G/T mismatch specific thymine DNA glycosylase
    • G/T mismatch-specific thymine DNA glycosylase
    • JZA 3
    • Jza1
    • T:G mismatch thymine glycosylase
    • Tdg
    • TDG_HUMAN
    • Thymine DNA glycosylase
    • Thymine-DNA glycosylase
    see all
  • FunctionIn the DNA of higher eukaryotes, hydrolytic deamination of 5-methylcytosine to thymine leads to the formation of G/T mismatches. This enzyme corrects G/T mispairs to G/C pairs. It is capable of hydrolyzing the carbon-nitrogen bond between the sugar-phosphate backbone of the DNA and a mispaired thymine. In addition to the G/T, it can remove thymine also from C/T and T/T mispairs in the order G/T >> C/T > T/T. It has no detectable activity on apyrimidinic sites and does not catalyze the removal of thymine from A/T pairs or from single-stranded DNA. It can also remove uracil and 5-bromouracil from mispairs with guanine.
  • Sequence similaritiesBelongs to the TDG/mug DNA glycosylase family.
  • Post-translational
    modifications
    Sumoylation on Lys-330 by either SUMO1 or SUMO2 induces dissociation of the product DNA.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human Thymine DNA glycosylase protein images

  • 12.5% SDS-PAGE showing ab114876 at approximately 71.17kDa.
    Stained with Coomassie Blue.

References for Recombinant Human Thymine DNA glycosylase protein (ab114876)

ab114876 has not yet been referenced specifically in any publications.

Product Wall

I can confirm that this product (ab114876: Human Thymine DNA glycosylase full length protein) has been tested and characterised for the use of ELISA, SDS-PAGE and Western blot. We have not done any tests for enzymatic activity yet, so we are not sure i...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"