Recombinant Human Thyrotropin Releasing Hormone (TRH) protein (ab159747)

Overview

  • Product name
    Recombinant Human Thyrotropin Releasing Hormone (TRH) protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPGPWLLLALALTLNLTGVPGGRAQPEAAQQEAVTAAEHPGLDDFLRQVE RLLFLRENIQRLQGDQGEHSASQIFQSDWLSKRQHPGKREEEEEEGVEEE EEEEGGAVGPHKRQHPGRREDEASWSVDVTQHKRQHPGRRSPWLAYAVPK RQHPGRRLADPKAQRSWEEEEEEEEREEDLMPEKRQHPGKRALGGPCGPQ GAYGQAGLLLGLLDDLSRSQGAEEKRQHPGRRAAWVREPLEE
    • Amino acids
      1 to 242
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159747 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Prothyroliberin
    • Protirelin
    • Thyroliberin
    • Thyroliberin [Precursor]
    • Thyrotropin releasing factor
    • Thyrotropin-releasing hormone
    • TRF
    • TRH
    • TSH releasing factor
    see all
  • Relevance
    Thyrotropin releasing hormone (TRH) is a tripeptide hormone that stimulates the release of thyroid stimulating hormone and prolactin by the anterior pituitary. TRH is produced by the hypothalamus and travels across the median eminence to the pituitary via the hypophyseal portal system. In addition to the brain, TRH can also be detected in other areas of the body including the gastrointestinal system and pancreatic islets.
  • Cellular localization
    Secreted

Images

  • ab159747 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159747 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159747.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up