Recombinant Human Thyroxine Binding Globulin protein (ab152725)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSPFLYLVLLVLGLHATIHCASPEGKVTACHSSQPNATLYKMSSINADFA FNLYRRFTVETPDKNIFFSPVSISAALVMLSFGACCSTQTEIVETLGFNL TDTPMVEIQHGFQHLICSLNFPKKELELQIGNALFIGKHLKPLAKFLNDV KTLYETEVFSTDFSNISAAKQEINSHVEMQTKGKVVGLIQDLKPNTIMVL VNYIHFKAQWANPFDPSKTEDSSSFLIDKTTTVQVPMMHQMEQYYHLVDM ELNCTVLQMDYSKNALALFVLPKEGQMESVEAAMSSKTLKKWNRLLQKGW VDLFVPKFSISATYDLGATLLKMGIQHAYSENADFSGLTEDNGLKLSNAA HKAVLHIGEKGTEAAAVPEVELSDQPENTFLHPIIQIDRSFMLLILERST RSILFLGKVVNPTEA
    • Molecular weight
      73 kDa including tags
    • Amino acids
      1 to 415

Specifications

Our Abpromise guarantee covers the use of ab152725 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 7
    • Serpin A7
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 7
    • Serpin peptidase inhibitor, clade A, member 7
    • Serpina7
    • T4 binding globulin
    • TBG
    • TBG, serum
    • THBG_HUMAN
    • Thyroxin binding globulin
    • Thyroxine binding globulin
    • Thyroxine-binding globulin
    • Thyroxine-binding globulin od serum
    see all
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152725 stained with Coomassie Blue.

References

ab152725 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152725.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up