Recombinant Human TIE1 protein (Fc Chimera) (ab54455)

Overview

Description

  • NatureRecombinant
  • SourceInsect cells
  • Amino Acid Sequence
    • AccessionP35590
    • SpeciesHuman
    • SequenceVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIVRT PPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNS PGAHLLPDKVTHTVNKGDTAVLSARVHKEKQTDVIWKSNGSYFYTLDWHE AQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRLIVRGCGAGRWGP GCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQC PGISGCRGLTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQ NGGTCDRFSGCVCPSGWHGVHCEKSDRIPQILNMASELEFNLETMPRINC AAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLADSG FWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFS GDGPISTVRLHYRPQDSTMDWSTIVVDPSENVTLMNLRPKTGYSVRVQLS RPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTDRLRVSWSLPLVP GPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQL YHCTLLGPASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPG PISKYVVEVQVAGGAGDPLWIDVDRPEETSTIIRGLNASTRYLFRMRASI QGLGDWSNTVEESTLGNGLQAEGPVQETRSDKTHTCPPCPAPELLGGPSV FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTK PREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK GQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENN YKTTPPMLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS LSLSPGK
    • Amino acids23 to 752
    • Additional sequence informationFused with the Fc region of Human IgG1 at the C-terminus.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab54455 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    Source: Insect cells. Purity: > 90%, by SDS-PAGE and visualised by silver stain. Endotoxin level: < 0.1 ng per µg sTIE-1/Fc.
  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: PBS

  • ReconstitutionThe protein can be reconstituted in ddH2O or PBS to a concentration of 100µg/ml.

General Info

  • Alternative names
    • JKT 14
    • JTK14
    • TIE
    • Tie1
    • TIE1_HUMAN
    • Tyrosine Kinase with Immunoglobulin and Epidermal Growth Factor Homology Domains
    • Tyrosine kinase with immunoglobulin and epidermal growth factor homology domains 1
    • Tyrosine kinase with immunoglobulin-like and EGF-like domains 1
    • Tyrosine protein kinase receptor Tie 1
    • Tyrosine-protein kinase receptor Tie-1
    see all
  • FunctionTransmembrane tyrosine-protein kinase that may modulate TEK/TIE2 activity and contribute to the regulation of angiogenesis.
  • Tissue specificitySpecifically expressed in developing vascular endothelial cells.
  • Sequence similaritiesBelongs to the protein kinase superfamily. Tyr protein kinase family. Tie subfamily.
    Contains 3 EGF-like domains.
    Contains 3 fibronectin type-III domains.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated on tyrosine residues in response to ANGPT1, most likely by TEK/TIE2.
  • Cellular localizationCell membrane.
  • Information by UniProt

References for Recombinant Human TIE1 protein (Fc Chimera) (ab54455)

ab54455 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab54455.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"