Recombinant Human TIF1 gamma protein (ab153358)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VKKKLQKKHSQHYQIPDDFVADVRLIFKNCERFNEMMKVVQVYADTQEIN LKADSEVAQAGKAVALYFEDKLTEIYSDRTFAPLPEFEQEEDDGEVTEDS
    • Amino acids
      1006 to 1105
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 8030451N04Rik
    • AI413936
    • cb1085
    • DKFZp586K1123
    • E3 ubiquitin-protein ligase TRIM33
    • EC 6.3.2.-
    • Ectodermin
    • Ectodermin homolog
    • FLJ11429
    • FLJ32925
    • id:ibd2175
    • MGC136680
    • mKIAA1113
    • OTTHUMP00000013662
    • OTTHUMP00000013663
    • Protein Rfg7
    • PTC7
    • Ret fused gene 7
    • RET-fused gene 7 protein
    • RFG7
    • Rfg7 protein
    • TF1G
    • TIF1-gamma
    • TIF1G
    • TIF1GAMMA
    • TIFGAMMA
    • Transcription intermediary factor 1-gamma
    • Transcriptional intermediary factor 1 gamma
    • TRI33_HUMAN
    • trim33
    • Tripartite motif containing 33
    • Tripartite motif containing 33 protein
    • tripartite motif-containing 33
    • Tripartite motif-containing protein 33
    • wu:fc17f10
    • zgc:136680
    see all
  • Function
    Acts as an E3 ubiquitin-protein ligase. Promotes SMAD4 ubiquitination, nuclear exclusion and degradation via the ubiquitin proteasome pathway. According to PubMed:16751102, does not promote a decrease in the level of endogenous SMAD4. May act as a transcriptional repressor. Inhibits the transcriptional response to TGF-beta/BMP signaling cascade. Plays a role in the control of cell proliferation. Its association with SMAD2 and SMAD3 stimulates erythroid differentiation of hematopoietic stem/progenitor (By similarity). Monoubiquitinates SMAD4 and acts as an inhibitor of SMAD4-dependent TGF-beta/BMP signaling cascade (Monoubiquitination of SMAD4 hampers its ability to form a stable complex with activated SMAD2/3 resulting in inhibition of TGF-beta/BMP signaling cascade).
  • Tissue specificity
    Expressed in stem cells at the bottom of the crypts of the colon (at protein level). Expressed in colon adenomas and adenocarcinomas (at protein level). Expressed in brain, lung, liver, spleen, thymus, prostate, kidney, testis, heart, placenta, pancreas, small intestine, ovary, colon, skeletal muscle and hematopoietic progenitors.
  • Pathway
    Protein modification; protein ubiquitination.
  • Involvement in disease
    Defects in TRIM33 are a cause of thyroid papillary carcinoma (TPC) [MIM:188550]. TPC is a common tumor of the thyroid that typically arises as an irregular, solid or cystic mass from otherwise normal thyroid tissue. Papillary carcinomas are malignant neoplasm characterized by the formation of numerous, irregular, finger-like projections of fibrous stroma that is covered with a surface layer of neoplastic epithelial cells. Note=A chromosomal aberration involving TRIM33 is found in thyroid papillary carcinomas. Translocation t(1;10)(p13;q11) with RET. The translocation generates the TRIM33/RET (PTC7) oncogene.
  • Sequence similarities
    Belongs to the TRIM/RBCC family.
    Contains 2 B box-type zinc fingers.
    Contains 1 bromo domain.
    Contains 1 PHD-type zinc finger.
    Contains 1 RING-type zinc finger.
  • Cellular localization
    Nucleus. In discrete nuclear dots resembling nuclear bodies.
  • Information by UniProt

Images

  • ab153358 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153358 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up