Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NQ88
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMARFALTVVRHGETRFNKEKIIQGQG VDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGILERSKFC KDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGETLD QVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNH SSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFLTDLKCSLPATLSRSEL MSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTETR
    • Molecular weight33 kDa including tags
    • Amino acids1 to 270
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101635 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • 6-bisphosphatase TIGAR
    • C12ORF5
    • chromosome 12 open reading frame 5
    • FR2BP
    • Fructose-2,6-bisphosphatase TIGAR
    • Fructose-2,6-bisphosphate 2-phosphatase
    • Probable fructose 2,6 bisphosphatase TIGAR
    • Probable fructose-2
    • tigar
    • TIGAR_HUMAN
    • TP53 induced glycolysis and apoptosis regulator
    • TP53 induced glycolysis regulatory phosphatase
    • TP53-induced glycolysis and apoptosis regulator
    • Transactivated by NS3TP2 protein
    see all
  • FunctionProbable fructose-biphosphatase. Lowers cellular levels of fructose 2,6-bisphosphate. Protects cells against reactive oxygen species and against apoptosis induced by p53/TP53.
  • Sequence similaritiesBelongs to the phosphoglycerate mutase family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

Recombinant Human TIGAR protein images

  • 15% SDS-PAGE analysis of 3 µg ab101635.

References for Recombinant Human TIGAR protein (ab101635)

ab101635 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"