Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9NQ88
    • SpeciesHuman
    • SequenceARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKF THAFSSDLMRTKQTMHGILERSKFCKDMTVKYDSRLRERKYGVVEGKALS ELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLCQLILKEADQKE QFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAY MRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPT VQCICMNLQDHLNGLTETRGGGYGRKKRRQRRR
    • Molecular weight36 kDa including tags
    • Amino acids1 to 270

Specifications

Our Abpromise guarantee covers the use of ab115509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level< 0.100 Eu/µg
  • Purity> 95 % SDS-PAGE.
    ab115509 is greater than 95% by SDS-PAGE gel and HPLC analyses.
  • FormLyophilised
  • Additional notesPretreatment with ab115509 for 4 hrs, using a concentration range 0.1-5.0 µg/ml, protects U2OS cells from apoptosis induced by hydrogen peroxide.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • 6-bisphosphatase TIGAR
    • C12ORF5
    • chromosome 12 open reading frame 5
    • FR2BP
    • Fructose-2,6-bisphosphatase TIGAR
    • Fructose-2,6-bisphosphate 2-phosphatase
    • Probable fructose 2,6 bisphosphatase TIGAR
    • Probable fructose-2
    • tigar
    • TIGAR_HUMAN
    • TP53 induced glycolysis and apoptosis regulator
    • TP53 induced glycolysis regulatory phosphatase
    • TP53-induced glycolysis and apoptosis regulator
    • Transactivated by NS3TP2 protein
    see all
  • FunctionProbable fructose-biphosphatase. Lowers cellular levels of fructose 2,6-bisphosphate. Protects cells against reactive oxygen species and against apoptosis induced by p53/TP53.
  • Sequence similaritiesBelongs to the phosphoglycerate mutase family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

References for Recombinant Human TIGAR protein (ab115509)

ab115509 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"