Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKF THAFSSDLMRTKQTMHGILERSKFCKDMTVKYDSRLRERKYGVVEGKALS ELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLCQLILKEADQKE QFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAY MRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPT VQCICMNLQDHLNGLTETRGGGYGRKKRRQRRR
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 270

Specifications

Our Abpromise guarantee covers the use of ab115509 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    > 95 % SDS-PAGE.
    ab115509 is greater than 95% by SDS-PAGE gel and HPLC analyses.
  • Form
    Lyophilised
  • Additional notes
    Pretreatment with ab115509 for 4 hrs, using a concentration range 0.1-5.0 µg/ml, protects U2OS cells from apoptosis induced by hydrogen peroxide.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • 6-bisphosphatase TIGAR
    • C12ORF5
    • chromosome 12 open reading frame 5
    • FR2BP
    • Fructose-2,6-bisphosphatase TIGAR
    • Fructose-2,6-bisphosphate 2-phosphatase
    • Probable fructose 2,6 bisphosphatase TIGAR
    • Probable fructose-2
    • tigar
    • TIGAR_HUMAN
    • TP53 induced glycolysis and apoptosis regulator
    • TP53 induced glycolysis regulatory phosphatase
    • TP53-induced glycolysis and apoptosis regulator
    • Transactivated by NS3TP2 protein
    see all
  • Function
    Probable fructose-biphosphatase. Lowers cellular levels of fructose 2,6-bisphosphate. Protects cells against reactive oxygen species and against apoptosis induced by p53/TP53.
  • Sequence similarities
    Belongs to the phosphoglycerate mutase family.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Information by UniProt

References

ab115509 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115509.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up