Recombinant Human TIMM17B protein (ab160900)

Overview

  • Product name
    Recombinant Human TIMM17B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEYAREPCPWRIVDDCGGAFTMGVIGGGVFQAIKGFRNAPVGIRHRLRG SANAVRIRAPQIGGSFAVWGGLFSTIDCGLVRLRGKEDPWNSITSGALTG AVLAARSGPLAMVGSAMMGGILLALIEGVGILLTRYTAQQFRNAPPFLED PSQLPPKDGTPAPGYPSYQQYH
    • Amino acids
      1 to 172
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160900 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DXS9822
    • Inner mitochondrial membrane preprotein translocase
    • JM3
    • Mitochondrial import inner membrane translocase subunit Tim17-B
    • TI17B_HUMAN
    • Tim17b
    • TIMM17B
    • Translocase of inner mitochondrial membrane 17 homolog B (yeast)
    see all
  • Function
    Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.
  • Tissue specificity
    Expression is abundant in heart and skeletal muscle, intermediate in brain, and weak in pancreas, placenta, kidney and liver.
  • Sequence similarities
    Belongs to the Tim17/Tim22/Tim23 family.
  • Cellular localization
    Mitochondrion inner membrane.
  • Information by UniProt

Images

  • ab160900 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160900 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160900.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up