Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPGSPRPAPSWVLLLRLLALLRPPGLGEACSCAPAHPQQHICHSALVIRA KISSEKVVPASADPADTEKMLRYEIKQIKMFKGFEKVKDVQYIYTPFDSS LCGVKLEANSQKQYLLTGQVLSDGKVFIHLCNYIEPWEGLSLVQRESLNH HYHLNCGCQITTCYTVPCTISAPNECLWTDWLLGRKLYGYQAQHYVCMKH VDGTCSWYRGHLPLRKEFVDIVQP
    • Amino acids
      1 to 224
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Metalloproteinase inhibitor 4
    • TIMP 4
    • TIMP metallopeptidase inhibitor 4
    • TIMP-4
    • Timp4
    • TIMP4_HUMAN
    • Tissue inhibitor of metalloproteinase 4
    • Tissue inhibitor of metalloproteinases 4
    see all
  • Function
    Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates them by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7 and MMP-9.
  • Tissue specificity
    Abundant in heart and present at low levels in many other tissues.
  • Sequence similarities
    Belongs to the protease inhibitor I35 (TIMP) family.
    Contains 1 NTR domain.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159706 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159706 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up