Overview

  • Product name
    Recombinant Human Tin2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RHFNLAPLGRRRVQSQWASTRGGHKERPTVMLFPFRNLGSPTQVISNPES KEEHAIYTADLAMGTRAPSNGKYKGPYQTLGGRALKENPVDLPATEQKE
    • Amino acids
      256 to 354
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153274 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AW552114
    • D14Wsu146e
    • DKCA3
    • MGC94711
    • TERF 1 (TRF 1) interacting nuclear factor 2
    • TERF 1 interacting nuclear factor 2
    • TERF1 (TRF1) interacting nuclear factor 2
    • TERF1 interacting nuclear factor 2
    • TERF1-interacting nuclear factor 2
    • Tin 2
    • TIN2
    • TINF 2
    • Tinf2
    • TINF2_HUMAN
    • TRF 1 interacting nuclear factor 2
    • TRF1 interacting nuclear factor 2
    • TRF1-interacting nuclear protein 2
    see all
  • Function
    Component of the shelterin complex (telosome) that is involved in the regulation of telomere length and protection. Shelterin associates with arrays of double-stranded TTAGGG repeats added by telomerase and protects chromosome ends; without its protective activity, telomeres are no longer hidden from the DNA damage surveillance and chromosome ends are inappropriately processed by DNA repair pathways. Plays a role in shelterin complex assembly.
  • Tissue specificity
    Detected in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Involvement in disease
    Defects in TINF2 are a cause of dyskeratosis congenita autosomal dominant (ADDKC) [MIM:127550]; also known as dyskeratosis congenita Scoggins type. ADDKC is a rare, progressive bone marrow failure syndrome characterized by the triad of reticulated skin hyperpigmentation, nail dystrophy, and mucosal leukoplakia. Early mortality is often associated with bone marrow failure, infections, fatal pulmonary complications, or malignancy.
    Defects in TINF2 are a cause of retinopathy exudative with bone marrow failure (ERBMF) [MIM:268130]; also known as Revesz syndrome. ERBMF is characterized by bilateral exudative retinopathy, bone marrow hypoplasia, nail dystrophy, fine hair, cerebellar hypoplasia, and growth retardation.
  • Domain
    The TBM domain mediates interaction with TERF1.
  • Cellular localization
    Nucleus. Chromosome > telomere. Associated with telomeres.
  • Information by UniProt

Images

  • ab153274 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153274 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153274.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up