Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WTGYKILIFSYLTTEIWMEKRYLSQREVDLEAYFTRNHTVLQGTRFKRAI FQGQYCRNFGCCEDRDDGCVTEFYAANALCYCDKFCDRENSDCCPDYKS
    • Amino acids
      2 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162130 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • TIN AG
    • TIN-Ag
    • TIN1
    • TIN2
    • TINAG
    • TINAG_HUMAN
    • Tubulointerstitial nephritis antigen
    see all
  • Function
    Mediates adhesion of proximal tubule epithelial cells via integrins alpha3-beta1 and alphaV-beta3. This is a non catalytic peptidase C1 family protein.
  • Tissue specificity
    Expressed in the kidney cortex, small intestine and cornea.
  • Sequence similarities
    Belongs to the peptidase C1 family.
    Contains 1 SMB (somatomedin-B) domain.
  • Developmental stage
    Initially observed in the Bowman capsule during early glomerular capillary loop formation in the kidney. In more developmentally mature glomeruli, following transition from early to mid-capillary loop stage, expression is higher in the proximal tubular basement membrane than in the distal basement membrane and Bowman capsule.
  • Post-translational
    modifications
    It has been suggested that the active SMB domain may be permitted considerable disulfide bond heterogeneity or variability, thus 2 alternate disulfide patterns based on 3D structures are described with 1 disulfide bond conserved in both.
  • Cellular localization
    Secreted > extracellular space > extracellular matrix > basement membrane.
  • Information by UniProt

Images

  • ab162130 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162130 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162130.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up