Recombinant Human TINAGL1 protein (ab163788)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTPVLSPQILLSCDTHQQQGCRGGRLDGAWWFLRRRGVVSDHCYPFSGRE RDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSN DKEIMKELMENGPAQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGT HSVKITGWGEETLPDGRTLKYWTAANSWGPAWGERGHFRIVRGVNECDIE SFVLGVWGRVGMEDMGHH
    • Amino acids
      1 to 218
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163788 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Androgen regulated gene 1
    • ARG1
    • GIS5
    • Glucocorticoid inducible protein
    • Glucocorticoid inducible protein 5
    • LCN7
    • LIECG3
    • Lipocalin 7
    • Lipocalin7
    • OLRG 2
    • OLRG2
    • Oxidized LDL responsive gene 2
    • Oxidized LDL responsive gene 2 protein
    • P3ECSL
    • TIN Ag related protein
    • TIN Ag RP
    • TINAG like 1
    • TINAGL
    • TINAGL 1
    • TINAGRP
    • Tubulointerstitial nephritis antigen like
    • Tubulointerstitial nephritis antigen like 1
    • Tubulointerstitial nephritis antigen related protein
    see all
  • Relevance
    TINAGL1 (Tubulointerstitial nephritis antigen-like 1) may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells.
  • Cellular localization
    Secreted

Images

  • ab163788 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163788 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163788.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up