Recombinant Human TINAGL1 protein (ab191923)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      AQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRADDCALPYLGAIC YCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWDN CNRCTCQENRQWQCDQEPCLVDPDMIKAINQGNYGWQAGNHSAFWGMTLD EGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEASEKWPNLIHEPL DQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDTHQQQGCR GGRLDGAWWFLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKR QATAHCPNSYVNNNDIYQVTPVYRLGSNDKEIMKELMENGPVQALMEVHE DFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKYW TAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHHVDHH HHHH
    • Molecular weight
      51 kDa including tags
    • Amino acids
      22 to 467
    • Tags
      His tag C-Terminus
    • Additional sequence information
      This product is the mature full length protein from aa 22 to 467. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191923 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 0.03% DTT, 0.03% EDTA, 99% Phosphate Buffer

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names
    • Androgen regulated gene 1
    • ARG1
    • GIS5
    • Glucocorticoid inducible protein
    • Glucocorticoid inducible protein 5
    • LCN7
    • LIECG3
    • Lipocalin 7
    • Lipocalin7
    • OLRG 2
    • OLRG2
    • Oxidized LDL responsive gene 2
    • Oxidized LDL responsive gene 2 protein
    • P3ECSL
    • TIN Ag related protein
    • TIN Ag RP
    • TINAG like 1
    • TINAGL
    • TINAGL 1
    • TINAGRP
    • Tubulointerstitial nephritis antigen like
    • Tubulointerstitial nephritis antigen like 1
    • Tubulointerstitial nephritis antigen related protein
    see all
  • Relevance
    TINAGL1 (Tubulointerstitial nephritis antigen-like 1) may be implicated in the adrenocortical zonation and in mechanisms for repressing the CYP11B1 gene expression in adrenocortical cells.
  • Cellular localization
    Secreted

References

ab191923 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191923.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up