Recombinant Human TIS11B protein (ab166490)

Overview

  • Product name
    Recombinant Human TIS11B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNTYTRSASFTPKTFTFPLAQNRTSHPTTTSKLKYLGRPSPRRDALQANG EGPEVGPGTEEPAHRLPVGSGSAGEAAASLGTARVRSGRAECTAKLAGDG HARLASAFLHRRAALPPPLGTCRPRLGEGGSAPALGPSPRRGRRVSEGLR DSLPPLGSLTLGKSPK
    • Molecular weight
      45 kDa
    • Amino acids
      1 to 166
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab166490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Berg36
    • BRF1
    • Butyrate response factor 1
    • C3H1 type-like 1
    • cMG1
    • EGF-response factor 1
    • ERF-1
    • ERF1
    • Protein TIS11B
    • RNF162B
    • TIS11B
    • TISB_HUMAN
    • ZFP36L1
    • Zinc finger protein 36
    see all
  • Function
    Probable regulatory protein involved in regulating the response to growth factors.
  • Sequence similarities
    Contains 2 C3H1-type zinc fingers.
  • Cellular localization
    Cytoplasm. Nucleus. Shuttles between the nucleus and the cytoplasm.
  • Information by UniProt

Images

  • ab166490 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab166490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab166490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up