Overview

  • Product name
    Recombinant Human TJAP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LELELGQSREELDKFKDKFRRLQNSYTASQRTNQELEDKLHTLIKKAEMD RKTLDWEIVELTNKLLDAKNTINKLEELNERYRLDCNPAVQLLKCNKSHF RNHK
    • Amino acids
      77 to 180
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PILT
    • Protein incorporated later into tight junctions
    • tight junction associated protein 1 peripheral
    • Tight junction protein 4
    • tight junction protein 4 peripheral
    • TJP4
    see all
  • Relevance
    The TJAP1 gene encodes a tight junction-associated protein. Incorporation of the encoded protein into tight junctions occurs at a late stage of formation of the junctions. The encoded protein may function in vesicle trafficking and localizes to the Golgi apparatus. Alternatively spliced transcript variants have been described. A related pseudogene exists on the X chromosome.
  • Cellular localization
    Golgi apparatus. Cell junction › tight junction. Note= Recruited to tight junctions (TJ) during late stages of maturation of the TJ complexes. Excluded from adherens junctions and desmosomes.

Images

  • ab164945 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164945 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164945.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up