Overview

  • Product name
    Recombinant Human TJP2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KVQVAALQASPPLDQDDRAFEVMDEFDGRSFRSGYSERSRLNSHGGRSRS WEDSPERGRPHERARSRERDLSRDRSRGRSLERGLDQDHARTRDRSRG
    • Amino acids
      121 to 218
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160480 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C9DUPq21.11
    • DFNA51
    • DUP9q21.11
    • Friedreich ataxia region gene X104 (tight junction protein ZO-2)
    • MGC26306
    • PFIC4
    • Tight junction protein 2
    • Tight junction protein ZO 2
    • Tight junction protein ZO-2
    • TJP2
    • X104
    • ZO 2
    • ZO-2
    • ZO2
    • ZO2_HUMAN
    • Zona occludens 2
    • Zona occludens protein 2
    • Zonula occludens protein 2
    see all
  • Function
    Plays a role in tight junctions and adherens junctions.
  • Tissue specificity
    This protein is found in epithelial cell junctions. Isoform A1 is abundant in the heart and brain. Detected in brain and skeletal muscle. It is present almost exclusively in normal tissues. Isoform C1 is expressed at high level in the kidney, pancreas, heart and placenta. Not detected in brain and skeletal muscle. Found in normal as well as in most neoplastic tissues.
  • Involvement in disease
    Defects in TJP2 are involved in familial hypercholanemia (FHCA) [MIM:607748]. FHCA is a disorder characterized by elevated serum bile acid concentrations, itching, and fat malabsorption.
  • Sequence similarities
    Belongs to the MAGUK family.
    Contains 1 guanylate kinase-like domain.
    Contains 3 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Cellular localization
    Cell junction > adherens junction. Cell membrane. Cell junction > tight junction. Nucleus. Also nuclear under environmental stress conditions and in migratory endothelial cells and subconfluent epithelial cell cultures.
  • Information by UniProt

Images

  • ab160480 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160480 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160480.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up