Recombinant Human TL1A protein (ab107131)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMLKGQEFAPSHQQVYAPLRADGDKPRAHLT VVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIY SQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKS VCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFL L
    • Molecular weight
      23 kDa including tags
    • Amino acids
      72 to 251
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Endotoxin level
    < 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab107131 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • MGC129934
    • MGC129935
    • tl1
    • TL1 A
    • tl1a
    • tnf ligand related molecule 1
    • TNF ligand-related molecule 1
    • tnf superfamily ligand tl1a
    • TNF15_HUMAN
    • TNFSF15
    • Tumor necrosis factor (ligand) superfamily member 15
    • Tumor necrosis factor ligand superfamily member 15
    • Tumor necrosis factor ligand superfamily member 15, secreted form
    • Vascular endothelial cell growth inhibitor
    • Vascular endothelial growth inhibitor
    • Vascular endothelial growth inhibitor 192a
    • vegi
    • VEGI192A
    see all
  • Function
    Receptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis.
  • Tissue specificity
    Specifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon.
  • Sequence similarities
    Belongs to the tumor necrosis factor family.
  • Cellular localization
    Secreted and Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab107131 (3µg).

References

ab107131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us This protein’s molecular weight was confirmed by MALDI-TOF, but we should mention that depending on your particular needs the buffer should be taken into consideration, as it contains 50% glycerol and 0.2M NaCl. As for this ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up