Recombinant Human TL1A protein (ab107131)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO95150
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMLKGQEFAPSHQQVYAPLRADGDKPRAHLT VVRQTPTQHFKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFIY SQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKS VCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFL L
    • Molecular weight23 kDa including tags
    • Amino acids72 to 251
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab107131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Endotoxin level< 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab107131 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 50% Glycerol, 0.2M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • MGC129934
    • MGC129935
    • tl1
    • TL1 A
    • tl1a
    • tnf ligand related molecule 1
    • TNF ligand-related molecule 1
    • tnf superfamily ligand tl1a
    • TNF15_HUMAN
    • TNFSF15
    • Tumor necrosis factor (ligand) superfamily member 15
    • Tumor necrosis factor ligand superfamily member 15
    • Tumor necrosis factor ligand superfamily member 15, secreted form
    • Vascular endothelial cell growth inhibitor
    • Vascular endothelial growth inhibitor
    • Vascular endothelial growth inhibitor 192a
    • vegi
    • VEGI192A
    see all
  • FunctionReceptor for TNFRSF25 and TNFRSF6B. Mediates activation of NF-kappa-B. Inhibits vascular endothelial growth and angiogenesis (in vitro). Promotes activation of caspases and apoptosis.
  • Tissue specificitySpecifically expressed in endothelial cells. Detected in monocytes, placenta, lung, liver, kidney, skeletal muscle, pancreas, spleen, prostate, small intestine and colon.
  • Sequence similaritiesBelongs to the tumor necrosis factor family.
  • Cellular localizationSecreted and Membrane.
  • Information by UniProt

Recombinant Human TL1A protein images

  • 15% SDS-PAGE showing ab107131 (3µg).

References for Recombinant Human TL1A protein (ab107131)

ab107131 has not yet been referenced specifically in any publications.

Product Wall

Thank you for contacting us This protein’s molecular weight was confirmed by MALDI-TOF, but we should mention that depending on your particular needs the buffer should be taken into consideration, as it contains 50% glycerol and 0.2M NaCl. As for this ...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"