Overview

  • Product name
    Recombinant Human TLE2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYPQGRHPTPLQSGQPFKFSILEICDRIKEEFQFLQAQYHSLKLECEKLA SEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLSGICAQIIPFLTQEHQ QQVLQAVERAKQVTVGELNSLIGQQLQPLSHHAPPVPLTPRPAGLVGGSA TGLLALSGALAAQAQLAAAVKEDRAGVEAEGSRVERAPSRSASPSPPESL VEEERPSGPGGGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSP ATTPCGKVPICIPARRDLVDSPASLASSLGSPLPRAKELILNDLPASTPA SKSCDSSPPQDASTPGPSSASHLCQLAAKPAPSTDSVALRSPLTLSSPFT TSFSLGSHSTLNGDLSVPSSYVSLHLSPQVSSSVVYGRSPVMAFESHPHL RGSSVSSSLPSIPGGKPAYSFHVSADGQMQPVPFPSDALVGAGIPRHARQ LHTLAHGEVVCAVTISGSTQHVYTGGKGCVKVWDVGQPGAKTPVAQLDCL NRDNYIRSCKLLPDGRSLIVGGEASTLSIWDLAAPTPRIKAELTSSAPAC YALAVSPDAKVCFSCCSDGNIVVWDLQNQTMVRQFQGHTDGASCIDISDY GTRLWTGGLDNTVRCWDLREGRQLQQHDFSSQIFSLGHCPNQDWLAVGME SSNVEILHVRKPEKYQLHLHESCVLSLKFASCGRWFVSTGKDNLLNAWRT PYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYEVVY
    • Amino acids
      1 to 743
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159711 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • enhancer of split groucho 2
    • Enhancer of split groucho-like protein 2
    • ESG
    • ESG2
    • FLJ41188
    • GRG2
    • Groucho2
    • KIAA4188
    • MGC124808
    • mKIAA4188
    • Tle2
    • Tle2 protein
    • TLE2_HUMAN
    • transducin like enhancer of split 2
    • Transducin like enhancer of split 2, homolog of Drosophila E(sp1)
    • Transducin like enhancer protein 2
    • Transducin-like enhancer of split 2 (E(sp1) homolog, Drosophila)
    • Transducin-like enhancer of split 2, homolog of Drosophila E(spl)
    • Transducin-like enhancer protein 2
    see all
  • Function
    Transcriptional corepressor that binds to a number of transcription factors. Inhibits the transcriptional activation mediated by CTNNB1 and TCF family members in Wnt signaling. The effects of full-length TLE family members may be modulated by association with dominant-negative AES.
  • Tissue specificity
    In all tissues examined, mostly in heart, brain, and muscle.
  • Sequence similarities
    Belongs to the WD repeat Groucho/TLE family.
    Contains 6 WD repeats.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159711 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159711 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159711.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up