Overview

  • Product name
    Recombinant Human TLE4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MIRDLSKMYPQTRHPAPHQPAQPFKFTISESCDRIKEEFQFLQAQYHSLK LECEKLASEKTEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNAICAQVIP FLSQEHQQQVVQAVERAKQVTMAELNAIIGQQLQAQHLSHGHGLPVPLTP HPSGLQPPAIPPIGSSAGLLALSSALGGQSHLPIKDEKKHHDNDHQRDRD SIKSSSVSPSASFRGAEKHRNSADYSSESKKQKTEEKEIAARYDSDGEKS DDNLVVDVSNEDPSSPRGSPAHSPRENGLDKTRLLKKDAPISPASIASSS STPSSKSKELSLNEKSTTPVSKSNTPTPRTDAPTPGSNSTPGLRPVPGKP PGVDPLASSLRTPMAVPCPYPTPFGIVPHAGMNGELTSPGAAYAGLHNIS PQMSAAAAAAAAAAAYGRSPVVGFDPHHHMRVPAIPPNLTGIPGGKPAYS FHVSADGQMQPVPFPPDALIGPGIPRHARQINTLNHGEVVCAVTISNPTR HVYTGGKGCVKVWDISHPGNKSPVSQLDCLNRDNYIRSCRLLPDGRTLIV GGEASTLSIWDLAAPTPRIKAELTSSAPACYALAISPDSKVCFSCCSDGN IAVWDLHNQTLVRQFQGHTDGASCIDISNDGTKLWTGGLDNTVRSWDLRE GRQLQQHDFTSQIFSLGYCPTGEWLAVGMENSNVEVLHVTKPDKYQLHLH ESCVLSLKFAHCGKWFVSTGKDNLLNAWRTPYGASIFQSKESSSVLSCDI SVDDKYIVTGSGDKKATVYEVIY
    • Molecular weight
      110 kDa including tags
    • Amino acids
      1 to 773

Specifications

Our Abpromise guarantee covers the use of ab152750 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • B lymphocyte gene 1
    • E(sp1) homolog Drosophila
    • E(spI)
    • enhancer of split groucho 4
    • ESG
    • ESG4
    • GRG4
    • KIAA1261
    • TIM
    • TIM1
    • timeless (Drosophila) homolog
    • TLE4
    • Transducin like enhancer protein 4
    • transducin-like enhancer of split 4
    see all
  • Relevance
    TLE4 (Transducin-like enhancer protein 4) is a member of the Groucho family of transcriptional corepressors and inhibits the transcriptional activation mediated by Pax5 and by beta-catenin and TCF family members in Wnt signaling.
  • Cellular localization
    Nuclear

Images

  • 12.5% SDS-PAGE analysis of ab152750 stained with Coomassie Blue.

References

ab152750 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152750.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up