Overview

  • Product name
    Recombinant Human TLE6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MATRSSDWLRRPLGEDNQPETQLFWDKEPWFWHDTLTEQLWRIFAGVHDE KAKPRDRQQAPGLGQESKAPGSCDPGTDPCPEDASTPRPPEASSSPPEGS QDRNTSWGVVQEPPGRASRFLQSISWDPEDFEDAWKRPDALPGQSKRLAV PCKLEKMRILAHGELVLATAISSFTRHVFTCGRRGIKVWSLTGQVAEDRF PESHLPIQTPGAFLRTCLLSSNSRSLLTGGYNLASVSVWDLAAPSLHVKE QLPCAGLNCQALDANLDANLAFASFTSGVVRIWDLRDQSVVRDLKGYPDG VKSIVVKGYNIWTGGPDACLRCWDQRTIMKPLEYQFKSQIMSLSHSPQED WVLLGMANGQQWLQSTSGSQRHMVGQKDSVILSVKFSPFGQWWASVGMDD FLGVYSMPAGTKVFEVPEMSPVTCCDVSSNNRLVVTGSGEHASVYQITY
    • Amino acids
      1 to 449
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ14009
    • GRG6
    • Groucho related protein 6
    • MGC14966
    • TLE 6
    • TLE6
    • TLE6_HUMAN
    • Transducin like enhancer of split 6
    • Transducin like enhancer of split 6 (E(sp1) homolog Drosophila)
    • Transducin like enhancer protein 6
    • Transducin-like enhancer protein 6
    see all
  • Function
    As a member of the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions.
  • Sequence similarities
    Belongs to the WD repeat Groucho/TLE family.
    Contains 7 WD repeats.
  • Cellular localization
    Cytoplasm. In the subcortical cytoplasm of early embryos from the 1-cell to the blastocyst stages. From the 2-cell stage, still detected in the subcortex, but excluded from cell-cell contact regions.
  • Information by UniProt

Images

  • ab164124 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up