Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO60602
    • SpeciesHuman
    • SequenceLPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQLLAPNPD VFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSF SGVSLFSLSTEGCDEEEV
    • Molecular weight39 kDa including tags
    • Amino acids517 to 634

Specifications

Our Abpromise guarantee covers the use of ab112363 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

    Other

  • FormLiquid
  • Additional notesBest to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ10052
    • MGC126430
    • MGC126431
    • SLEB1
    • TIL 3
    • TIL3
    • TLR 5
    • Tlr5
    • TLR5_HUMAN
    • Toll like receptor 5
    • Toll like receptor 5 precursor
    • Toll-like receptor 5
    • Toll/interleukin 1 receptor like protein 3
    • Toll/interleukin-1 receptor-like protein 3
    see all
  • FunctionParticipates in the innate immune response to microbial agents. Mediates detection of bacterial flagellins. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificityHighly expressed in ovary and in peripheral blood leukocytes, especially in monocytes, less in CD11c+ immature dendritic cells. Also detected in prostate and testis.
  • Involvement in diseaseSystemic lupus erythematosus 1
  • Sequence similaritiesBelongs to the Toll-like receptor family.
    Contains 22 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Post-translational
    modifications
    Phosphorylated at Ser-805 by PKD/PRKD1; phosphorylation induces the production of inflammatory cytokines.
    Phosphorylated at Tyr-798 upon flagellin binding; required for signaling.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human TLR5 protein images

  • 12.5% SDS-PAGE showing ab112363 at approximately 38.61 kDa, stained with Coomassie Blue.

References for Recombinant Human TLR5 protein (ab112363)

ab112363 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112363.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"