Recombinant Human TLR7 protein (ab153341)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ARWFPKTLPCDVTLDVPKNHVIVDCTDKHLTEIPGGIPTNTTNLTLTINH IPDISPASFHRLDHLVEIDFRCNCVPIPLGSKNNMCIKRLQIKPRSFSGL
    • Amino acids
      27 to 126
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153341 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PRO285
    • TLR 7
    • Tlr7
    • TLR7_HUMAN
    • Toll like receptor 7
    • Toll-like receptor 7
    • UNQ248
    see all
  • Function
    Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. TLR7 is a nucleotide-sensing TLR which is activated by single-stranded RNA. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificity
    Detected in brain, placenta, spleen, stomach, small intestine, lung and in plasmacytoid pre-dendritic cells.
  • Sequence similarities
    Belongs to the Toll-like receptor family.
    Contains 27 LRR (leucine-rich) repeats.
    Contains 1 TIR domain.
  • Cellular localization
    Endoplasmic reticulum membrane. Endosome. Lysosome. Cytoplasmic vesicle > phagosome. Relocalizes from endoplasmic reticulum to endosome and lysosome upon stimulation with agonist.
  • Information by UniProt

Images

  • ab153341 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153341 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.

Actually, no antibody was used to create these images:

As the purified, recombinant tagged fragments/proteins were used, the gels could directly be stained with Coomassie.

Coomassie stains all p...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up