Recombinant Human TLR8 protein (ab153344)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MENMFLQSSMLTCIFLLISGSCELCAEENFSRSYPCDEKKQNDSVIAECS NRRLQEVPQTVGKYVTELDLSDNFITHITNESFQGLQNLTKINLNHNPNV QHQNGNPGIQSNGLNITDGAFLNLKNLRELLLEDNQLPQIPSGLPESLTE LSLIQNNIYNITKEGISRLINLKNLYLAWNCYFNKVCEKTNIEDGVFETL TNLELLSLSFNSLSHVPPKLPSSLRKLFLSNTQIKYISEEDFKGLINLTL LDLSGNCPRCFNAPFPCVPCDGGASINIDRFAFQNLTQLRYLNLSSTSLR KINAAWFKNMPHLKVLDLEFNYLVGEIASGAFLTMLPRLEILDLSFNYIK GSYPQHINISRNFSKLLSLRALHLRGYVFQELREDDFQPLMQLPNLSTIN LGINFIKQIDFKLFQNFSNLEIIYLSENRISPLVKDTRQSYANSSSFQRH IRKRRSTDFEFDPHSNFYHFTRPLIKPQCAAYGKALDLSLNSIFFIGPNQ FENLPDIACLNLSANSNAQVLSGTEFSAIPHVKYLDLTNNRLDFDNASAL TELSDLEVLDLSYNSHYFRIAGVTHHLEFIQNFTNLKVLNLSHNNIYTLT DKYNLESKSLVELVFSGNRLDILWNDDDNRYISIFKGLKNLTRLDLSLNR LKHIPNEAFLNLPASLTELHINDNMLKFFNWTLLQQFPRLELLDLRGNKL LFLTDSLSDFTSSLRTLLLSHNRISHLPSGFLSEVSSLKHLDLSSNLLKT INKSALETKTTTKLSMLELHGNPFECTCDIGDFRRWMDEHLNVKIPRLVD VICASPGDQRGKSIVSLELTTCVSDVTAVILFFFTFFITTMVMLAALAHH LFYWDVWFIYNVCLAKVKGYRSLSTSQTFYDAYISYDTKDASVTDWVINE LRYHLEESRDKNVLLCLEERDWDPGLAIIDNLMQSINQSKKTVFVLTKKY AKSWNFKTAFYLALQRLMDENMDVIIFILLEPVLQHSQYLRLRQRICKSS ILQWPDNPKAEGLFWQTLRNVVLTENDSRYNNMYVDSIKQY
    • Amino acids
      1 to 1041
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153344 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CD 288
    • CD288
    • CD288 antigen
    • MGC119599
    • MGC119600
    • TLR 8
    • Tlr8
    • TLR8_HUMAN
    • Toll like receptor 8
    • Toll-like receptor 8
    see all
  • Function
    Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific of microorganisms. Acts via MYD88 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response.
  • Tissue specificity
    Detected in brain, heart, lung, liver, placenta, in monocytes, and at lower levels in CD11c+ immature dendritic cells.
  • Sequence similarities
    Belongs to the Toll-like receptor family.
    Contains 23 LRR (leucine-rich) repeats.
    Contains 1 LRRCT domain.
    Contains 1 TIR domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab153344 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153344 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Thank you for contacting us.

Actually, no antibody was used to create these images:

As the purified, recombinant tagged fragments/proteins were used, the gels could directly be stained with Coomassie.

Coomassie stains all p...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up