Overview

  • Product name
    Recombinant Human TLX2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAF SGGYHGASGYGPAGSLAPLPGSSGVGPGGVIRVPAHRPLPVPPPAGGAPA VPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQ NRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQ VKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPD PLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV
    • Amino acids
      1 to 284
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158665 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Enx
    • homeo box 11 like 1
    • Homeobox protein Hox 11L1
    • Homeobox TLX 2
    • HOX11L1
    • NCX
    • Neural crest homeobox protein
    • PMUR10F
    • T cell leukemia homeobox protein 2
    • T cell leukemia, homeobox 2
    see all
  • Relevance
    TLX2 contains 1 homeobox DNA-binding domain and the function remains unknown. In the mouse, this gene is expressed from embryonic day 9.5 through day 13.5 and is detectable in the dorsal root ganglia, cranial and enteric nerve ganglia and adrenal glands. In adult animals its expression is limited to the adrenal gland and the intestine. TLX2 may be involved in the proliferation and/or differentiation of enteric peripheral nervous system.
  • Cellular localization
    Nuclear

Images

  • ab158665 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158665 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158665.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up