Overview

  • Product name
    Recombinant Human TM2D1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      WGAVATSAGGEESLKCEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSC FPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNGYSYKVAVALSLFLG WLGADRFYLGYPALGLLKFCTVGFCGIGSLIDFILISMQIVGPSDGSSYI IDYYGTRLTRLSITNETFRKTQLYP
    • Amino acids
      33 to 207
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164469 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BBP
    • Beta amyloid binding protein
    • hBBP
    • TM2 domain containing 1
    • TM2 domain containing protein 1
    • TM2D1
    see all
  • Relevance
    The protein encoded by this gene is a beta-amyloid peptide-binding protein. It contains a structural module related to that of the seven transmembrane domain G protein-coupled receptor superfamily and known to be important in heterotrimeric G protein activation. Beta-amyloid peptide has been established to be a causative factor in neuron death and the consequent diminution of cognitive abilities observed in Alzheimer's disease. This protein may be a target of neurotoxic beta-amyloid peptide, and may mediate cellular vulnerability to beta-amyloid peptide toxicity through a G protein-regulated program of cell death.
  • Cellular localization
    Membrane; Multi-pass membrane protein

Images

  • ab164469 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164469 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164469.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up