Recombinant Human TM9SF2 protein (ab160460)

Overview

  • Product name
    Recombinant Human TM9SF2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KKETCKLVCTKTYHTEKAEDKQKLEFLKKSMLLNYQHHWIVDNMPVTWCY DVEDGQRFCNPGFPIGCYITDKGHAKDACVISSDFHERDTFYIFNHVDIK
    • Amino acids
      116 to 215
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160460 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • p76
    • TM9S2_HUMAN
    • Tm9sf2
    • Transmembrane 9 superfamily member 2
  • Function
    In the intracellular compartments, may function as a channel or small molecule transporter.
  • Tissue specificity
    Ubiquitously expressed. Especially abundant in pancreas, highly expressed in kidney, lower levels in heart, brain, skeletal muscle and placenta. Lowest expression in lung and liver.
  • Sequence similarities
    Belongs to the nonaspanin (TM9SF) family.
  • Cellular localization
    Endosome membrane.
  • Information by UniProt

Images

  • ab160460 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160460 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160460.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up