Overview

  • Product name
    Recombinant Human TMC6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAHSFGESYRVGSTSGIHAITVFCSWDYKVTQKRASRLQQDNIRTRLKEL LAEWQLRHSPRSVCGRLRQAAVLGLVWLLCLGTALGCAVAVHVFSEFMIQ SPEAAGQEAVLLVLPLVVGLLNLGAPYLCRVLAALEPHDSPVLEVYVAIC RNLILKLAILGTLCYHWLGRRVGVLQGQCWEDFVGQELYRFLVMDFVLML LDTLFGELVWRIISEKKLKRRRKPEFDIARNVLELIYGQTLTWLGVLFSP LLPAVQIIKLLLVFYVKKTSLLANCQAPRRPWLASHMSTVFLTLLCFPAF LGAAVFLCYAVWQVKPSSTCGPFRTLDTMYEAGRVWVRHLEAAGPRVSWL PWVHRYLMENTFFVFLVSALLLAVIYLNIQVVRGQRKVICLLKEQISNEG EDKIFLINKLHSIYERKEREERSRVGTTEEAAAPPALLTDEQDA
    • Amino acids
      1 to 444
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161415 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Epidermodysplasia verruciformis protein 1
    • EV1
    • EVER1
    • EVIN1
    • LAK 4P
    • LAK4P
    • Protein LAK 4
    • Protein LAK4
    • Transmembrane channel like protein 6
    see all
  • Relevance
    Defects in TMC6 are a cause of epidermodysplasia verruciformis, a rare autosomal recessive genodermatosis associated with a high risk of skin carcinoma that results from an abnormal susceptibility to infection by specific human papillomaviruses. Infection leads to persistent wart-like or macular lesions. TMC6 is expressed in placenta, prostate, testis, activated T-lymphocytes and lymphokine-activated killer (LAK) lymphocytes. There are four named isoforms.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi-pass membrane protein

Images

  • ab161415 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161415 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161415.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up