Overview

  • Product name
    Recombinant Human TMCO1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSTMFADTLLIVFISVCTALLAEGITWVLVYRTDKYKRLKAEVEKQSKKL EKKKETITESAGRQQKKKIERQEEKLKNNNRDLSMVRMKSMFAIGFCFTA LMGMFNSIFDGRVVAKLPFTPLSYIQGLSHRNLLGDDTTDCSFIFLYILC TMSIRQNIQKILGLAPSRAATKQAGGFLGPPPPSGKFS
    • Amino acids
      1 to 188
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1190006A08Rik
    • 4930403O06Rik
    • AA109065
    • AU022572
    • Calcium load activated calcium channel
    • CFSMR
    • CLAC channel
    • ESTM39
    • HP10122
    • Meg 2 like protein
    • PCIA3
    • PNAS 10
    • PNAS 136
    • Putative membrane protein
    • RP11-466F5.7
    • TMCC4
    • TMCO1
    • TMCO1_HUMAN
    • Transmembrane and coiled coil domains 1
    • Transmembrane and coiled coil domains 4
    • Transmembrane and coiled-coil domain-containing protein 1
    • Transmembrane and coiled-coil domains protein 4
    • Xenogeneic cross-immune protein PCIA3
    see all
  • Tissue specificity
    Expressed abundantly in thymus, prostate, testis and small intestine, and to a lower extent in brain, placenta, lung and kidney.
  • Sequence similarities
    Belongs to the TMCO1 family.
  • Cellular localization
    Endoplasmic reticulum membrane. Golgi apparatus membrane.
  • Information by UniProt

Images

  • ab162757 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up