Overview

  • Product name
    Recombinant Human TMED2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YFVSIDAHAEECFFERVTSGTKMGLIFEVAEGGFLDIDVEITGPDNKGIY KGDRESSGKYTFAAHMDGTYKFCFSNRMSTMTPKIVMFTIDIGEAPKGQD METEAHQNKLEEMINELAVAMTAVKHEQEYMEVRERIHRAINDNTNSRVV LWSFFEALVLVAMTLGQIYYLKRFFEVRRVV
    • Amino acids
      21 to 201
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161217 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • coated vesicle membrane protein
    • Membrane protein p24A
    • p24
    • p24 family protein beta-1
    • P24A
    • p24beta1
    • RNP24
    • Sid 394
    • Sid394
    • TMED2
    • TMED2_HUMAN
    • transmembrane emp24 domain trafficking protein 2
    • Transmembrane emp24 domain-containing protein 2
    see all
  • Function
    Could have a role in the budding of coatomer-coated and other species of coated vesicles. Could bind cargo molecules to collect them into budding vesicles.
  • Sequence similarities
    Belongs to the EMP24/GP25L family.
    Contains 1 GOLD domain.
  • Cellular localization
    Cytoplasmic vesicle membrane. Cytoplasmic vesicle > COPI-coated vesicle membrane. Golgi apparatus membrane. Golgi-derived coatomer-coated vesicles.
  • Information by UniProt

Images

  • ab161217 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161217 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161217.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up