Overview

  • Product name
    Recombinant Human TMED4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAGVGAGPLRAMGRQALLLLALCATGAQGLYFHIGETEKRCFIEEIPDET MVIGNYRTQMWDKQKEVFLPSTPGLGMHVEVKDPDGKVVLSRQYGSEGRF TFTSHTPGDHQICLHSNSTRMALFAGGKLRVHLDIQVGEHANNYPEIAAK DKLTELQLRARQLLDQVEQIQKEQDYQRYREERFRLTSESTNQRVLWWSI AQTVILILTGIWQMRHLKSFFEAKKLV
    • Amino acids
      1 to 227
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Endoplasmic reticulum stress-response protein 25
    • ERS25
    • GMP25iso
    • HNLF
    • p24 family protein alpha-3
    • p24alpha3
    • Putative NF-kappa-B-activating protein 156
    • Putative NFkB activating protein HNLF
    • TMED4
    • TMED4_HUMAN
    • Transmembrane emp24 domain containing protein 4
    • Transmembrane emp24 domain-containing protein 4
    • Transmembrane emp24 protein transport domain containing 4
    see all
  • Function
    Involved in vesicular protein trafficking, mainly in the early secretory pathway. targeting. Involved in the maintenance of the Golgi apparatus. Appears to play a role in the biosynthesis of secreted cargo including processing. Involved in endoplasmic reticulum stress response. May play a role in the regulation of heat-shock response and apoptosis.
  • Sequence similarities
    Belongs to the EMP24/GP25L family.
    Contains 1 GOLD domain.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab165984 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up