Recombinant Human TMEM38A protein (ab163968)

Overview

  • Product name
    Recombinant Human TMEM38A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELLSALSLGELALSFSRVPLFPVFDLSYFIVSILYLKYEPGAVELSRRH PIASWLCAMLHCFGSYILADLLLGEPLIDYFSNNSSILLASAVWYLIFFC PLDLFYKCVCFLPVKLIFVAMKEVVRVRKIAVGIHHAHHHYHHGWFVMIA TGWVKGSGVALMSNFEQLLRGVWKPETNEILHMSFPTKASLYGAILFTLQ QTRWLPVSKASLIFIFTLFMVSCKVFLTATHSHSSPFDALEGYICPVLFG SACGGDHHHDNHGGSHSGGGPGAQHSAMPAKSKEELSEGSRKKKAKKAD
    • Amino acids
      1 to 299
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC3169
    • TM38A_HUMAN
    • TMEM 38A
    • TMEM38A
    • Transmembrane protein 38A
    • TRIC A
    • TRIC-A
    • TRICA
    • Trimeric intracellular cation channel type A
    see all
  • Function
    Monovalent cation channel required for maintenance of rapid intracellular calcium release. May act as a potassium counter-ion channel that functions in synchronization with calcium release from intracellular stores.
  • Sequence similarities
    Belongs to the TMEM38 family.
  • Domain
    The second transmembrane domain has been proposed to cross only half of the lipid bilayer and to loop back into the cytosol, so that the domains on each side of this domain are both found on the cytosolic face of the membrane. The cytosolic loop may form an ion-conducting pore.
  • Cellular localization
    Sarcoplasmic reticulum membrane. Nucleus membrane.
  • Information by UniProt

Images

  • ab163968 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up