Recombinant Human TMEPAI protein (ab163440)

Overview

  • Product name
    Recombinant Human TMEPAI protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NRTIFDSDLMDSARLGGPCPPSSNSGISATCYGSGGRMEGPPPTYSEVIG HYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIWSKEKDKQKGHPL
    • Amino acids
      181 to 280
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PMEPA_HUMAN
    • PMEPA1
    • Prostate transmembrane protein, androgen induced 1
    • Solid tumor associated 1 protein
    • Solid tumor-associated 1 protein
    • STAG1
    • TMEPAI
    • Transmembrane prostate androgen induced protein
    • Transmembrane prostate androgen-induced protein
    • Transmembrane, prostate androgen induced RNA
    see all
  • Function
    Involved in down-regulation of the androgen receptor (AR). Enhances ubiquitination and proteasome-mediated degradation of AR, probably by recruiting NEDD4.
  • Tissue specificity
    Highest expression in prostate. Also expressed in ovary.
  • Sequence similarities
    Belongs to the PMEPA1 family.
  • Domain
    The WW-binding motifs mediate interaction with NEDD4.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab163440 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up