Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MWYHRLSHLHSRLQDLLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLT CAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASV DLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRI LWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQE HTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQE PCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHE YIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQ CDIPERILTYRHFVSGTSIEHRGSLI
    • Amino acids
      1 to 376
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AUTSX6
    • BBOX2
    • Butyrobetaine (gamma) 2 oxoglutarate dioxygenase (gamma butyrobetaine hydroxylase) 2
    • Epsilon-trimethyllysine 2-oxoglutarate dioxygenase
    • Epsilon-trimethyllysine hydroxylase
    • FLJ10727
    • TML dioxygenase
    • TML hydroxylase
    • TML-alpha-ketoglutarate dioxygenase
    • TMLD
    • TMLH
    • TMLH_HUMAN
    • TMLHE
    • TMLHED
    • Trimethyllysine dioxygenase, mitochondrial
    • Trimethyllysine hydroxylase epsilon
    • XAP130
    see all
  • Function
    Converts trimethyllysine (TML) into hydroxytrimethyllysine (HTML).
  • Tissue specificity
    All isoforms, but isoform 8, are widely expressed in adult and fetal tissues. Isoform 8 is restricted to heart and skeletal muscle.
  • Pathway
    Amine and polyamine biosynthesis; carnitine biosynthesis.
  • Involvement in disease
    Autism, X-linked 6
  • Sequence similarities
    Belongs to the gamma-BBH/TMLD family.
  • Cellular localization
    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab163019 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up