Recombinant Human TMPRSS11D protein (ab160473)

Overview

  • Product name
    Recombinant Human TMPRSS11D protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYRPARVTSTSRFLNPYVVCFIVVAGVVILAVTIALLVYFLAFDQKSYFY RSSFQLLNVEYNSQLNSPATQEYRTLSGRIESLITKTFKESNLRNQFIRA HVAKLRQDGSGVRADVVMKFQFTRNNNGASMKSRIESVLRQMLNNSGNLE INPSTEITSLTDQAAANWLINECGAGPDLITLSEQRILGGTEAEEGSWPW QVSLRLNNAHHCGGSLINNMWILTAAHCFRSNSNPRDWIATSGISTTFPK LRMRVRNILIHNNYKSATHENDIALVRLENSVTFTKDIHSVCLPAATQNI PPGSTAYVTGWGAQEYAGHTVPELRQGQVRIISNDVCNAPHSYNGAILSG MLCAGVPQGGVDACQGDSGGPLVQEDSRRLWFIVGIVSWGDQCGLPDKPG VYTRVTAYLDWIRQQTGI
    • Amino acids
      1 to 418
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160473 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Airway trypsin like protease
    • Airway trypsin-like protease
    • HAT
    • MGC150587
    • MGC150588
    • TM11D_HUMAN
    • TMPRSS11D
    • Transmembrane protease serine 11D
    • Transmembrane protease serine 11D catalytic chain
    • Transmembrane protease serine 11D precursor
    see all
  • Function
    May play some biological role in the host defense system on the mucous membrane independently of or in cooperation with other substances in airway mucous or bronchial secretions.
  • Tissue specificity
    Located in the cells of the submucosal serous glands of the bronchi and trachea.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 1 SEA domain.
  • Cellular localization
    Secreted. Activated by cleavage and secreted and Cell membrane. Activated by cleavage and secreted.
  • Information by UniProt

Images

  • ab160473 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160473 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160473.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up