Recombinant Human TMPRSS2 protein (ab112364)

Overview

  • Product name
    Recombinant Human TMPRSS2 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQG NVDSCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTD WIYRQMRADG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      383 to 492

Specifications

Our Abpromise guarantee covers the use of ab112364 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D16Ertd61e
    • Epitheliasin
    • FLJ41954
    • MGC6821
    • PP9284
    • PRSS10
    • Serine protease 10
    • TMPRSS2
    • TMPRSS2 ERG FUSION GENE, INCLUDED
    • TMPRSS2 ETV1 FUSION GENE, INCLUDED
    • TMPS2_HUMAN
    • Transmembrane protease serine 2 catalytic chain
    • Transmembrane protease, serine 2
    • Transmembrane protease, serine 2, EC 3.4.219
    see all
  • Tissue specificity
    Expressed strongly in small intestine. Also expressed in prostate, colon, stomach and salivary gland.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 LDL-receptor class A domain.
    Contains 1 peptidase S1 domain.
    Contains 1 SRCR domain.
  • Cellular localization
    Cell membrane and Secreted. Activated by cleavage and secreted.
  • Information by UniProt

Recombinant Human TMPRSS2 protein images

  • 12.5% SDS-PAGE showing ab112364 at approximately 37.73 kDa, stained with Coomassie Blue.

References for Recombinant Human TMPRSS2 protein (ab112364)

ab112364 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112364.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up