Recombinant Human TMPRSS5 protein (ab164309)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVERIIPHPLYSAQNHDY DVALLRLQTALNFSDTVGAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYS
    • Amino acids
      258 to 357
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164309 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • MGC141886
    • MGC148044
    • OTTHUMP00000238209
    • OTTHUMP00000238210
    • OTTHUMP00000238211
    • OTTHUMP00000238212
    • OTTHUMP00000238213
    • Spinesin
    • TMPRSS 5
    • TMPRSS5
    • TMPS5_HUMAN
    • Transmembrane protease serine 5
    • Transmembrane protease, serine 5
    • Transmembrane protease, serine 5 (spinesin)
    see all
  • Function
    May play a role in hearing.
  • Tissue specificity
    Brain-specific. Predominantly expressed in neurons, in their axons, and at the synapses of motoneurons in the spinal cord.
  • Involvement in disease
    Note=Defects in TMPRSS5 may be a cause of deafness.
  • Sequence similarities
    Belongs to the peptidase S1 family.
    Contains 1 peptidase S1 domain.
    Contains 1 SRCR domain.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab164309 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164309 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164309.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up