Recombinant human TNF Receptor I protein (Fc Chimera) (ab83577)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • AccessionP19438
    • SpeciesHuman
    • SequenceTheoretical Sequence: IYPSGVIGLVPHLGDREKRDSVCPQGKYIHPQNNSICCT KCHKGTYLY NDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKE MGQVEISSC TVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHL SCQEKQNTV CTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKG TEDSGIPKV DKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDT LMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNS TYRVVSVLT VLHQDWLNGKEYKCRVSNKALPAPIEKTISKAKGQPREP QVYTLPPSR DELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTT PPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS LSPGK
    • Amino acids22 to 209
    • Additional sequence informationFusion of aa 1-209 of human TNF Receptor 1 and aa 93-330 of Fc region of human IgG1 (P01857). The chimeric protein was expressed in modified human 293 cells.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab83577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activityActivity: The ND50 of ab83577 is typically 15-30 ng/ml as measured by its ability to neutralize TNF-a mediated cytoxicity in murine WEHI 164 cells in the presence of actinomycin D.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • CD120a
    • FPF
    • MGC19588
    • p55
    • p55-R
    • p60
    • TBP1
    • TBPI
    • TNF R
    • TNF R55
    • TNF-R1
    • TNF-RI
    • TNFAR
    • TNFR-I
    • TNFR1
    • TNFR55
    • TNFR60
    • TNFRI
    • TNFRSF1a
    • TNR1A_HUMAN
    • Tumor necrosis factor receptor 1
    • Tumor necrosis factor receptor superfamily, member 1A
    • Tumor necrosis factor receptor type 1
    • Tumor necrosis factor receptor type I
    • Tumor necrosis factor-binding protein 1
    see all
  • FunctionReceptor for TNFSF2/TNF-alpha and homotrimeric TNFSF1/lymphotoxin-alpha. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Contributes to the induction of non-cytocidal TNF effects including anti-viral state and activation of the acid sphingomyelinase.
  • Involvement in diseaseFamilial hibernian fever
    Multiple sclerosis 5
  • Sequence similaritiesContains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • DomainThe domain that induces A-SMASE is probably identical to the death domain. The N-SMASE activation domain (NSD) is both necessary and sufficient for activation of N-SMASE.
    Both the cytoplasmic membrane-proximal region and the C-terminal region containing the death domain are involved in the interaction with TRPC4AP.
  • Post-translational
    modifications
    The soluble form is produced from the membrane form by proteolytic processing.
  • Cellular localizationCell membrane. Golgi apparatus membrane. Secreted. A secreted form is produced through proteolytic processing and Secreted. Lacks a Golgi-retention motif, is not membrane bound and therefore is secreted.
  • Information by UniProt

Recombinant human TNF Receptor I protein (Fc Chimera) images

  • Densitometry scan demonstrating the purified human cell expressed protein exists in multiple isoforms, which differ according to their level of post-translational modification. The triangle indicates the theoretical MW and pI of the protein.
  • 1D SDS-PAGE of ab83577 before and after treatment with glycosidases to remove oligosaccharides.
    Lane 1 – MW markers; Lane 2 – ab83577 ; Lane 3 – ab83577 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83577 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. 10 µg protein loaded per lane.

    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. Slight drop in MW after treatment with glycosidase cocktail suggests presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.

References for Recombinant human TNF Receptor I protein (Fc Chimera) (ab83577)

ab83577 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab83577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"