Recombinant human TNF Receptor II protein (ab168884)

Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      LPAQVAFTPYAPEPGSTCRLREYYDQTAQMCCSKCSPGQHAKVFCTKTSD TVCDSCEDST YTQLWNWVPECLSCGSRCSSDQVETQACTREQNRICTCRPGWYCALSKQE GCRLCAPLRK CRPGFGVARPGTETSDVVCKPCAPGTFSNTTSSTDICRPHQICNVVAIPG NASMDAVCTS TSPTRSMAPGAVHLPQPVSTRSQHTQPTPEPSTAPSTSFLLPMGPSPPAE GSTGD
    • Molecular weight
      26 kDa including tags
    • Amino acids
      23 to 257
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab168884 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity
    Measured by its ability to inhibit TNFa mediated cytotoxicity in L-929 mouse fibroblast cells in the presence of the metabolic inhibitor actinomycin D. The ED50 for this effect is typically 0.05-0.5 µg/mL in the presence of 0.25 ng/mL recombinant Human TNFa.
  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    pH: 7.40
    Constituent: 95% PBS
    Note: 5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 400 µg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names
    • CD120b
    • p75
    • p75 TNF receptor
    • p75TNFR
    • p80 TNF alpha receptor
    • p80 TNF-alpha receptor
    • Soluble TNFR1B variant 1
    • TBP-2
    • TBPII
    • TNF R II
    • TNF R2
    • TNF R75
    • TNF-R2
    • TNF-RII
    • TNFBR
    • TNFR-II
    • TNFR1B
    • TNFR2
    • TNFR80
    • TNFRII
    • Tnfrsf1b
    • TNR1B_HUMAN
    • Tumor necrosis factor beta receptor
    • Tumor necrosis factor binding protein 2
    • Tumor necrosis factor receptor 2
    • Tumor necrosis factor receptor superfamily member 1B
    • Tumor necrosis factor receptor type II
    • Tumor necrosis factor-binding protein 2
    see all
  • Function
    Receptor with high affinity for TNFSF2/TNF-alpha and approximately 5-fold lower affinity for homotrimeric TNFSF1/lymphotoxin-alpha. The TRAF1/TRAF2 complex recruits the apoptotic suppressors BIRC2 and BIRC3 to TNFRSF1B/TNFR2. This receptor mediates most of the metabolic effects of TNF-alpha. Isoform 2 blocks TNF-alpha-induced apoptosis, which suggests that it regulates TNF-alpha function by antagonizing its biological activity.
  • Sequence similarities
    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications
    Phosphorylated; mainly on serine residues and with a very low level on threonine residues.
    A soluble form (tumor necrosis factor binding protein 2) is produced from the membrane form by proteolytic processing.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

Images

  • Reduced SDS-PAGE showing ab168884 with overnight Coomassie Blue staining.

References

ab168884 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab168884.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up